DPCstruct | MC10791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 5.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 66.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06943 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314XXE8 | 1-71 | MQSADQVGQVKCGSCAVLPMYPYGASSVRCSSCQFVTEIGEHNKRPPWSVQQGHPPPPANAVHETAYVRRA |
| A0A251JDJ6 | 33-95 | VLEAHEIGQVNCGGCAVLLMYPYGASSVRCSSCHFITEIGVHNRRPPWSVIQGYPPPSPNPVQ |
| A0A5N6Q8U9 | 1-72 | None |
| A0A7J7LHM4 | 548-611 | None |
| A0A498IS57 | 48-116 | None |
| A0A059C9I8 | 391-452 | None |
| A0A7J8V8G6 | 110-168 | None |
| M1CWQ7 | 79-142 | None |
| A0A4D9B3X2 | 255-306 | None |
| O65426 | 89-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.