DPCstruct | MC1079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 143 ± 25 aa |
| Standard deviation of domain lengths | 25.08 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820AW56 | 7-142 | VSNAIVYSQSFTYFTTPSSQCTDWTTFRALLVGSSYTSLTISGTNDPTGITLTNAVYVNAIAQALRTYSSYGPVSSNSYSWAVGGCG… |
| A0A814MJV7 | 144-309 | TTTTTTTATTTTTTTTTTTTTTTATTTTTTTSNAIVYSQSFTYFTTPSSQCTDWTTFRALLVGSSYTSLTISGTNDPTGITLTNAVY… |
| A0A816SK79 | 166-329 | None |
| A0A815MAE8 | 223-374 | None |
| A0A816X118 | 192-351 | None |
| A0A819ZVB5 | 7-155 | None |
| A0A820CHT9 | 115-233 | None |
| A0A820WLT3 | 2-95 | None |
| A0A815MS27 | 62-200 | None |
| A0A815KAJ1 | 68-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.