DPCstruct | MC10788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Standard deviation of domain lengths | 12.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 63.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P3Z5X2 | 42-169 | TKSTGDTSLAEKPECQRGMRLILSLCLSEGFDTFPTLLCADGCCMIDRRMGVYGYPIEIQALFFMALRCALLLLKQDDVGKEFVERI… |
| A0A314XNK5 | 2-108 | RLILSLCLSEGFDTFPTLLCADGCCMIDRRKGIYGYPIEIQALFFMALRCALALLKQDDEGKEFVERIVKRLHALSYHMRSYFWLDF… |
| A0A4P1RKF5 | 221-349 | None |
| A0A0B2P5G1 | 293-420 | None |
| A0A4S8IQ18 | 732-859 | None |
| A0A6J0N478 | 27-154 | None |
| A0A4S8JCZ2 | 761-888 | None |
| D7MPT3 | 8-110 | None |
| A0A6A3CM72 | 142-288 | None |
| A0A3Q7EP44 | 689-831 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.