DPCstruct | MC10784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 158 ± 6 aa |
| Standard deviation of domain lengths | 6.45 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 64.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 55.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4Z8S7 | 1-158 | MSEEREFSKPVTPDEEVVRRNICVTFAVPVEVEPPEEENGSDLPSRWRALVRTVVYQMVLEVEARGEPRCSSCRKPATDLPTGEYRP… |
| A0A6G0KZR4 | 191-340 | MSVKESNESPPEPVTDERLVAGNICMTFAGPEVEGPSLEEPAVIPFRLRALIRSVVYQIVLEEEARSELRCPACLDADTSQSEDSGT… |
| A0A6A4DT89 | 350-510 | None |
| A0A6A3KAA4 | 9-179 | None |
| A0A6A3ZE02 | 1-152 | None |
| A0A6A4CG24 | 628-787 | None |
| A0A6A3SAQ9 | 431-585 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.