DPCstruct | MC10782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 132 ± 11 aa |
| Standard deviation of domain lengths | 10.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5A633 | 166-307 | SKDERALFIKKSTQVLFITEYVILVEYVEVVLPVVYVAYRSVLFYMPNRAFYASMTELTIGQLLSSALNVLAYSSLEFGSLIISAIV… |
| G4Z432 | 148-285 | EEIDEAEEKRVVEDSLQALFHAEYILLAEYIEFTIPLFYAPYLVAIFHLPVGAFYPPHTAATTASKLGETVTSILIYSAVEFVAFGA… |
| A0A5D6Y5E6 | 470-600 | None |
| G4ZG57 | 211-322 | None |
| G4ZIT8 | 12-152 | None |
| A0A6A3TQ31 | 265-400 | None |
| A0A6A3UD14 | 14-167 | None |
| A0A6A3V6N1 | 14-156 | None |
| A0A662WW16 | 522-650 | None |
| W2MCW0 | 2-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.