DPCstruct | MC10781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 9.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4Z2U9 | 28-131 | KVREVSVSNVLVVNPTNAVVTVNKNWGDKATLSNIWVKSSKAAVKVCQWSQGNPKGEPSILGHGPSGTLCQYSTSDVHINQDMKQAK… |
| A0A510V9I1 | 39-127 | RSCGNCSKQYARTVVVDNIKVTAPGKSLVGINSNLGDKATITNVTISNDASKRIVICEEYKGVTSGEPSKIGSGPSAACGYSTSSIT… |
| A0A2P4XIG7 | 124-224 | None |
| A0A5J6HX28 | 157-247 | None |
| A0A0W8CB90 | 248-337 | None |
| A0A272EU38 | 252-347 | None |
| A0A6V7WSV9 | 94-191 | None |
| A0A6G0XE98 | 157-259 | None |
| A0A0G4NJK8 | 771-862 | None |
| A0A5D6Y883 | 165-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.