DPCstruct | MC10779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 283 ± 26 aa |
| Standard deviation of domain lengths | 26.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2LFM1 | 260-523 | RLSAHGANNYHRLGLAYLLVEGLMSDLFLLTTQEGMLGRLQCISLGYNLAGIMSMLFEMIETMHWLGETNRCFLRRVLFNHETVLVG… |
| G4YNU2 | 1-315 | MRLSAHGAKNVHRLLLMFLLVDQGVMSDFFLLSTQEGIFGRIQSISLGYNLAGLMSMVFEMMETMNWMNEKLRCQVKRLLFNYETVL… |
| W2YU19 | 260-523 | None |
| W2ZJC9 | 678-991 | None |
| W2IJB1 | 969-1258 | None |
| A0A0W8C1F2 | 1-266 | None |
| A0A0W8C7D3 | 36-350 | None |
| A0A0W8B5E9 | 1-312 | None |
| A0A662XNE3 | 700-981 | None |
| A0A6A3P2L3 | 427-676 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.