DPCstruct | MC10775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 143 ± 3 aa |
| Standard deviation of domain lengths | 2.75 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4YGC7 | 1-146 | MSGLLDLAVPGAGSAVDVLLKIVQLGNEMREVQQSCKRLHGRLDVVFNELKMMEEKGQQPQSSAVDKYVDVLAKSLQCLEHYRAKKL… |
| A0A5D6YHL6 | 11-155 | VLEFVVPGIGGTIFLALDTMSSLCYEMKENEVMCRRVLERLQFVWDELQKIQDENMLRDNQVLPKFGGAINNFMTFLKKHSRKKLLS… |
| K3X5G2 | 1-142 | None |
| A0A662WWU6 | 124-266 | None |
| A0A080YZW1 | 2-146 | None |
| A0A6A4DA10 | 3-148 | None |
| H3GQP0 | 8-148 | None |
| A0A2P4YAA3 | 1-142 | None |
| A0A329T1Q6 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.