DPCstruct | MC10774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 113 ± 7 aa |
| Standard deviation of domain lengths | 6.70 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5PEA3 | 10-113 | VFQAWQRGVEIAGPRWFADGQTSPDSATSKWDLSPRVDEIRSAIGWLSSGEAMFLAAMVSFYNSEPGGELLRSLGANGLSDIAASLD… |
| I2IGU8 | 114-221 | APEAFFQAWKRGVEIAGTEWFGDGTRDGLKRATTKWDLRPNVLMLSDALGVLSGNQRMFLAAMVSIYDAREGGAMLRRCGFEGFSDL… |
| A0A4Q6X030 | 15-136 | None |
| A0A369CEJ6 | 19-129 | None |
| A0A0S8ERX6 | 46-148 | None |
| A0A3G7U593 | 23-129 | None |
| A9IB63 | 13-130 | None |
| A0A6F8PB40 | 68-187 | None |
| A0A3N8DP84 | 14-126 | None |
| A0A1L3R8Z0 | 268-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.