DPCstruct | MC10769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 269 ± 33 aa |
| Standard deviation of domain lengths | 32.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 36.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4EBG6 | 395-659 | ETGTNKPDTDEKEDETGKASVITSQEITLDCSQAENCGAHASWYTAYNKIGHQGFNTSDLLKELYPEMYSNPKIATYIEKGIEGYYG… |
| A0A3B0JHM8 | 143-392 | KMGDKVVENENREIISQKITADHVDITKCGSTGVYYNSYKHVGCHGFYTSDLLEAFYPEMYSNPKIAEHLKLGSKVFYGAVNYKFAF… |
| A0A0U1DC37 | 86-344 | None |
| A0A5E4NGX6 | 1-315 | None |
| A0A8A8PG52 | 229-493 | None |
| A0A5C0YT45 | 269-542 | None |
| A0A5C0YMW2 | 2-299 | None |
| A0A6I5SYC0 | 85-380 | None |
| A0A218KMX8 | 123-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.