DPCstruct | MC10767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 170 ± 22 aa |
| Standard deviation of domain lengths | 22.49 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9PIC4 | 1-165 | MLLAVLASGATACASRPPPEALAATRDALSGLDEFGALLLGAGLPVEAIPEGRSVSPVQAERLRRHLAILPYLPQHYAPRFVADEML… |
| A0A3A8GXZ2 | 1-158 | MLAATDDFGMLLIGAGLSPEDLPRGEEVTVQEASQLRLLLSLVGNSLRGFGPNVTADYLLAEVVTKGEAVSRTTLGERLRRFQALAV… |
| A0A2T4VF85 | 1-162 | None |
| A0A3A8SSW5 | 66-244 | None |
| A0A7Y4IZ24 | 1-171 | None |
| A0A410S4D1 | 25-207 | None |
| A0A7Y6X651 | 30-185 | None |
| A0A3A8TJR5 | 3-156 | None |
| A0A3A5G5U1 | 60-254 | None |
| A0A3A8QRJ1 | 1-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.