DPCstruct | MC10766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 113 ± 16 aa |
| Standard deviation of domain lengths | 16.47 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7U895 | 3-118 | TTRLYRPVGLKEMELIAETDYKLFPPRLDWQPIFYPVTNQEYAEQIAFEWNTVDEFSGFIGVVTAFEVKNAFLEKYEVQNVGDKNHN… |
| S9PE11 | 16-134 | PPRTQTLYRPVGLLELELILDAGSRAFPPRLPEQPIFYPVLNAGYAEQIARDWNPPDVRSGFAGYVTSFEVEADYLRAFDVKVVGDS… |
| D3Q0V0 | 149-258 | None |
| A0A533B439 | 285-391 | None |
| A0A3R6SM06 | 2-117 | None |
| A0A7X8JVV6 | 2-115 | None |
| A0A1P8WKC0 | 264-370 | None |
| A0A1W1X6X5 | 271-383 | None |
| A0A4R2RN03 | 134-245 | None |
| A0A559QSW0 | 3-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.