DPCstruct | MC10763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 87 ± 4 aa |
| Standard deviation of domain lengths | 3.72 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 56.89 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0642- CL0541 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3PZ30 | 17-104 | YRDASVTGLLRHYSDPATCLFFEPLLSRPLPRSFPFTLQHLCRAVICSRTTYRGVDDLPLPPQLRDYLRQYHVRNSKLLAASLLVTEL |
| A0A0N4X300 | 100-188 | EQGNHRFSFDIHDQSVFSAPTITKLIEKYKDPARCLFFEPQLTHPLHRGRVFSLQELCRGVIVSRTTYTGVASLRLPPKLKQYIREY… |
| A0A4U5LY73 | 1-90 | None |
| A0A7R9GAP7 | 343-431 | None |
| A0A0N4U197 | 275-362 | None |
| A0A0R3PZ68 | 166-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.