DPCstruct | MC10762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09360 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0A9T1 | 32-97 | MARIVLHERNHPYAIKLDNGKEIHVCACGLSKNKPYCDGSHRKTQDEEDGKIYMYDENGNRVKIVS |
| A0A1S8AZK6 | 1-72 | MTRLVELEANGPRKLEPDDIDDEKGDVAVCQCGLSDDFPFCDGSHRRTRDEADGTTYVYEDGQRREVKRVVT |
| A0A2R6HZQ0 | 1-78 | None |
| A0A4Y3G0Q6 | 8-77 | None |
| A0A2M7BTV6 | 1-70 | None |
| A0A4P9DS36 | 1-60 | None |
| V4HI84 | 16-84 | None |
| A0A0G1L5Q1 | 12-75 | None |
| A0A0G1JPF1 | 1-67 | None |
| A0A7C2QLS6 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.