DPCstruct | MC10761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 102 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A238YLC5 | 210-291 | SAVGLRSTPARYIFLDEVDAYPASADEEGDPVTLAEARSLTFAHRRKVLLVSTPTIRGLSRIEREYEVSDQRRYFVPCPHCG |
| A0A3F3IG14 | 1-124 | MFRDGSFLKIGWPSIIVFSSSDYKRVALTDYDRFPEDIDGEGDGFSLASKRTTTFMSAGMTLAESSPGREITDVKWRRSSPHEAPPT… |
| A0A059UUJ4 | 4-107 | None |
| A0A063ZY87 | 160-248 | None |
| A0A7W6FW72 | 20-120 | None |
| A8TUC3 | 5-106 | None |
| A0A376U8Q0 | 36-134 | None |
| A0A379US00 | 1-124 | None |
| A0A826M9V4 | 13-111 | None |
| A0A823BTI0 | 39-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.