DPCstruct | MC1076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 102 ± 13 aa |
| Standard deviation of domain lengths | 13.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 42.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3F2V901 | 1-85 | MLGANGTKTASKTLWKGKGKERIDVENPNPGQRPGQVHYQDNKNNKYLYDPETKSFPNAPKSVNKMLSDKKFRAAIDKAMTKYLG |
| A0A0S3KAX9 | 90-191 | GIGISAIGGGDSLLGANGTQVTSKTMWQNGGTERLDVENPAPGERAGQIHYHEPNNTKWLYDPKSKKFIHPKSGELAPPKIQKKLND… |
| A0A378PLM0 | 233-341 | None |
| A0A4S5E6I3 | 631-737 | None |
| A0A7X7T4F2 | 201-277 | None |
| A0A499VCZ7 | 6-101 | None |
| A0A3A8KEF2 | 52-142 | None |
| A0A7U5BZA5 | 1-121 | None |
| A0A0N1GQV2 | 958-1048 | None |
| A0A7C3QK20 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.