DPCstruct | MC10758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 213 ± 18 aa |
| Standard deviation of domain lengths | 17.95 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9VX35 | 6-224 | AEHIIMEYSPGVPERNLKLKELMSTVKMLQDILHAGYTVVNIEDKDANHNPSLDGTLPPMDQVTLRNLAYDERDVKLISEQKLGCPM… |
| A0A835YF69 | 171-380 | VENIVMEYSPGVPERHMMVEEEMETVRMLARFMHRGYRIGHIGSGSDDLGSWGEPVQPMREVTLDNLKYDMTDLRMWKNRTLGCPPR… |
| A0A5J4Y965 | 548-737 | None |
| I0Z0U8 | 302-514 | None |
| A0A7S0RQU5 | 239-447 | None |
| A0A7S0RPS9 | 66-295 | None |
| A0A830HR95 | 673-851 | None |
| A0A835XNJ3 | 241-451 | None |
| A0A0D2M151 | 124-343 | None |
| A0A150GUW6 | 291-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.