DPCstruct | MC10756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 182 ± 43 aa |
| Standard deviation of domain lengths | 42.58 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9VWJ8 | 54-256 | RRRMVLVVDSNASLAFERLAGATSAVHMRPLLLLSPPHRPSALRDTSATGCFFTMALTCPVMATCLMLGEVAPQPPALAALESALEA… |
| A0A2H1CKN8 | 29-175 | VCLLSPEVIPESLESSRHRGNIFTLFLHCPLTAFCFVCGLGTVQLKTWDAARGVLDAFLTECYRILIRSRSLDYSYVQFLVDDFLRL… |
| A0A5N6Q1F7 | 199-407 | None |
| A0A7M5VEA1 | 59-229 | None |
| A0A4Y7KQE9 | 169-367 | None |
| A0A2V0PLE0 | 432-687 | None |
| L9JDX3 | 263-500 | None |
| A0A1Y1W115 | 431-641 | None |
| A0A803Q4A2 | 522-722 | None |
| W1NIR3 | 2-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.