DPCstruct | MC10755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Standard deviation of domain lengths | 9.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453EU45 | 14-123 | GQWFYRPEEADKKGGGNWTASDTRELFYSFHIDDVPAESVMHKCVVHFIPLNKQIPSRKEHPGFIVQKVYDTVAKKLWNLTDKDYED… |
| A0A7R9VI12 | 1-133 | VRDCLNTEELVGKLVTTPCSFEVLDQKTGQPTRKVDDELLKEVFFSCHRDTIKTGTIVHKVIVRFLGREYSQSKEKTTKLKLLPGFL… |
| A0A287KXS6 | 27-119 | None |
| K3XS26 | 206-302 | None |
| A0A396GQN0 | 119-227 | None |
| A0A453EUB3 | 82-177 | None |
| A0A396HF11 | 55-148 | None |
| A0A068UPH6 | 79-171 | None |
| A0A7J0FSL0 | 265-360 | None |
| A0A7J0FT85 | 127-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.