DPCstruct | MC10752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 11.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 49.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9V950 | 4-99 | MAASLLYKMCSKGKVPGVSVNPELFQEVYTSKYGKVRIYKVIDVDMESRAWLADSSNYQCDRPGSWYCPGQYPPKLPLEVRKGHAKL… |
| A0A3L6L958 | 70-153 | TPMMQRSLLYNLHRFGTDGGKTQLDKNMFQLAYVSKYGLVKIYKVMNVSEESKAWVADPKNRVCDPPGSWICAGQYPPAKEIQD |
| A0A7S0NL57 | 355-454 | None |
| A0A813FJU4 | 488-580 | None |
| A0A7S0TR03 | 64-159 | None |
| A0A7R9ZSF0 | 7-115 | None |
| A0A504XK01 | 1034-1137 | None |
| A0A7S2PI18 | 329-435 | None |
| A0A1Q9D9W9 | 1071-1155 | None |
| A0A2V2WUT7 | 136-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.