DPCstruct | MC1075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 10.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 34.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N3ESE7 | 1-81 | MENTSYISEISYKVEVWLYQGYSIKSIDKEIKELQGEGMFPKNLKLIDAYLDKSYGSSGCAFLDTNTGETIIGFAGTNDRN |
| A0A0S3KA41 | 11-108 | IKKDSETTSTAATISYEVENALEQGGKKSDVNKQINRLQKGEKFPSNLQLVDAFYDPKTSSSGVAFLDNSTGKVVVVFAGTNFDNVF… |
| A0A081R0L6 | 9-105 | None |
| A0A200J6U2 | 1-93 | None |
| A8AXX7 | 13-119 | None |
| A0A8A8TA48 | 2-77 | None |
| A0A2L0D372 | 3-83 | None |
| A0A2N6QFJ2 | 3-93 | None |
| A0A0A0DFB5 | 6-98 | None |
| A0A380DQ98 | 6-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.