DPCstruct | MC10748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 573 ± 63 aa |
| Standard deviation of domain lengths | 63.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X4K5L8 | 16-609 | LRFEFRVGRDTEGPLRTISADVTRDGAFVASLICEALREEPATGQATGTVRFRGHPDLVSGSLRLEVDGRGIGSFYLAVDLEGNYRD… |
| A0A2T1DTZ5 | 69-599 | NRYHSYLKVTNVQFSPVITTAHCHLTLTIDEYRYTQPPAGSFDGSFPTTPSRTVTAVLSPKASPVGLSGPYFEGKLYETGVEKGTFS… |
| A0A7Y4VX61 | 96-674 | None |
| A0A7C8P174 | 53-719 | None |
| A0A0J9E7Q4 | 232-852 | None |
| A0A7Y5XTA4 | 1-457 | None |
| A0A523JPF8 | 570-1077 | None |
| A0A239C133 | 465-1089 | None |
| A0A1Q3LM05 | 45-555 | None |
| A0A6I7PD47 | 73-708 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.