DPCstruct | MC10747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 166 ± 21 aa |
| Standard deviation of domain lengths | 21.30 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2SS94 | 1-143 | MITITMSKVDAAIGTLRDKIGQVDQHHASKAIKAAEKLLLALESARNEYEIDLKNPHTDIENAGKQFKQKCETAINKAKPILEKDLG… |
| A0A0W0U097 | 25-201 | LPNKGIFELLEFARKYESQAVVNYLEDQKKLEVTTRLAPVEQALVELRIKLTVVDQYNYARAHKEANRLLERLESSRDRYRDKLSKE… |
| G9ERF4 | 185-331 | None |
| G9EMH9 | 1-176 | None |
| A0A222P413 | 508-676 | None |
| A0A0W0YHW3 | 355-499 | None |
| A0A0A2SUH9 | 103-272 | None |
| A0A0W0SK82 | 391-607 | None |
| A0A0A8UN14 | 273-415 | None |
| A0A0W0XZD6 | 144-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.