DPCstruct | MC10745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 147 ± 22 aa |
| Standard deviation of domain lengths | 22.32 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A410Q8G3 | 1-149 | MARRKTTKTPPMKFYKKLVLNQFFLKLFGVNKFEELAEELKKVKNEGYTGENNTYYYEYLTLNFADKCSIARDELLKYDENIVRHTF… |
| A0A1B9F4C9 | 1-148 | MASFDKKLALFHWLLCQFGAEEFVQLKKILSNDDLIGFDEENSTLFSHELSEHLKASQSPISKEMLSSYDANIVRHWKKITKKRNSS… |
| A0A7X7ESM3 | 1-140 | None |
| A0A2M7A4A3 | 5-126 | None |
| A0A379APQ3 | 8-182 | None |
| Q8Q0E3 | 1-97 | None |
| A0A519Q4W5 | 14-177 | None |
| X2K214 | 3-156 | None |
| A0A6L7T813 | 1-124 | None |
| A0A2A2SL65 | 6-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.