DPCstruct | MC10742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1226 |
|---|---|
| Mean domain length (aa) | 91 ± 15 aa |
| Standard deviation of domain lengths | 15.41 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.80 |
| Pfam Score | 94.10 |
| Assigned Pfam label(s) | CL0464- CL0123- PF10150- CL0319- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V0WWG6 | 8-92 | VAKHAVGARVKGVVQSFASHGAYVRIGDVAGYLPVRLMKSPAPRTPREHVKIGESLTLSVSDFNQSRRSIEVSLMPVEKSVATKA |
| A0A379D2N0 | 107-207 | AERDVADWLYARFLKDKAGTDTRFSAEIIDISRGGMRVRLVDNGAVAFIPAPFIHAVRDELVCSQENGTVQIKGETAYRVSDVIDVT… |
| A0A7S2BNI7 | 67-151 | None |
| A0A1R3KUM6 | 183-278 | None |
| A0A226EM90 | 79-168 | None |
| A0A3M1GQ92 | 155-232 | None |
| A0A6L6C6B4 | 226-310 | None |
| A0A6M6E272 | 6-85 | None |
| A0A0G4HQ10 | 45-127 | None |
| M1V5J5 | 111-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.