DPCstruct | MC10741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 146 ± 25 aa |
| Standard deviation of domain lengths | 25.02 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11258 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P5SEI5 | 1-137 | MLKNKLITVLITLGLSVSAIAGTGFTANAESGASPLSGLPGGEGKPVVMVKFGNSKPDRPHYNLNQADLIYVEEVEWGLTRVAAMFN… |
| A0A2A9HJ31 | 12-135 | ILPLAVMFDNTPNAIPHHGIGEADLVYEALVEGGITRLMAVFWRRDPGLIMPVRSARTPFVIWVDELGALYSHAGSATTTNEANAAG… |
| A0A641AKA3 | 108-273 | None |
| A0A2V2F3R1 | 32-173 | None |
| A0A1Q2CVL8 | 12-138 | None |
| A0A523E0K0 | 37-179 | None |
| A0A2E0RU76 | 394-513 | None |
| A0A391NY58 | 17-183 | None |
| A0A6N7WBS6 | 3-115 | None |
| A0A7V5C209 | 257-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.