DPCstruct | MC10740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 193 ± 36 aa |
| Standard deviation of domain lengths | 36.27 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061NYU0 | 7-174 | TLTPHKRILPTGFQTDYRTKIIPHVKRIDRLLLPFEDRQIGKLSLSAVSNIFDLISETLVMDEGYSFHVDDVKAMMAYAAKKDFAHI… |
| A0A4P5SC21 | 36-193 | PRGIQPTRSAVVQNLAEDCIVGGANHFPISPGQDNASVLDSKLANYDETVSYHVCDSTLASQLLAFSGEDELGGIPCIQFIEALKNI… |
| A0A7Y2QCB4 | 16-223 | None |
| A0A061NF93 | 82-304 | None |
| A0A2S1XTG3 | 6-145 | None |
| A0A3C1INL1 | 534-764 | None |
| A0A255TS63 | 555-794 | None |
| A0A135HXD1 | 8-138 | None |
| A0A8B2BQF3 | 14-179 | None |
| A0A4R0ZIL0 | 465-665 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.