DPCstruct | MC1074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 246 ± 51 aa |
| Standard deviation of domain lengths | 51.29 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.11 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | PF01867- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q0UC04 | 2-188 | IAKDILLDKVKLHKLHLEKYEIDLNIKLILKKIEKAQNIDELMGIEGSFAKTYFKEFFSLLPKNMHKNKRSKNPPQDPANAVLSLFY… |
| A0A3A9YKA9 | 193-442 | QIVCFGRVGVTSTLLQRVVERGIELAWLYEDGRHAARVSGLDGTDPELRLAQYRAAGDDRRALRIARQMVAGKVTNMRVGLLRAARA… |
| A0A5R8QK29 | 65-338 | None |
| A0A1W1BCX0 | 140-443 | None |
| A0A2P1MJP2 | 2-128 | None |
| A0A353V2X4 | 69-378 | None |
| A0A3M1TRM0 | 529-863 | None |
| A0A840PXN1 | 2-183 | None |
| A0A5J5DYB8 | 93-293 | None |
| A0A1B9C050 | 2-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.