DPCstruct | MC10739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 171 ± 36 aa |
| Standard deviation of domain lengths | 35.67 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.12 |
| Pfam Score | 94.29 |
| Assigned Pfam label(s) | PF09174- PF19681 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4L5C4 | 33-181 | YSFDQKEYPAVGNVEAMFRLLKNTIETSFPDFDFSWLIHQHFKIVESSEEAQSNIGWTVISNVPSSQAILSNLWAGIEKEIQPSNCM… |
| A0A191V502 | 109-283 | GAVVGRGASDARDDGRANAAVLPFRAGGWAREPEARFFTLPNPLSLDDFGISFIKELPLRCLAGEGSHRGRALACVTTADDVLNELF… |
| A0A1C7NGA4 | 27-203 | None |
| A0A5S6QKS9 | 3-120 | None |
| A0A2P9CZG8 | 177-343 | None |
| A0A7S1F621 | 13-225 | None |
| A0A5C8M6C5 | 3-132 | None |
| A0A5K4EG59 | 2-123 | None |
| L8GGI1 | 141-318 | None |
| A0A7J6SAQ4 | 36-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.