DPCstruct | MC10738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 10.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4JPP6 | 316-434 | EIVKMFFQRKNNSKCRFPHKLYNALILSQLDPNLYHLVGAKWIDRIHILIKRSAFSRLLGIRSIEGSLFHQQGNFPSHGFEEIDPSV… |
| A0A1J4L0F3 | 7-115 | LKSFAESIKQLSFPEKLQMCLELTTKMPPATNQVGLKWITDTIFIANVKIFARFIKSISNTVNYNFRHHLIKRLGRVTSTEYDDTMH… |
| A0A1J4JTM2 | 46-151 | None |
| A0A1J4JYH8 | 58-184 | None |
| A2D997 | 98-223 | None |
| A2DF95 | 203-328 | None |
| A2FN22 | 57-183 | None |
| A2DHD9 | 7-117 | None |
| A2FHB1 | 3-130 | None |
| A2FK14 | 16-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.