DPCstruct | MC10737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 104 ± 8 aa |
| Standard deviation of domain lengths | 7.88 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4KVK1 | 143-244 | LTQAAIQGLVKQTQSVEKDRVRQKLAGFDPKTSPACNYINSKFGQDVRQHCLCEMAKYIAKKRQIVLDRDSKRRKSVLLKWFHDKWE… |
| A0A1J4L075 | 47-146 | NPKQHESKSEVQNEDRKKADIRLQGFNPLESQVWREICQKYGSSLSQNELLSLAEVIASHIGTRVDREAKRRKEVLIKWFDENSEKI… |
| A0A1J4JGZ4 | 4-111 | None |
| A2FWA3 | 4-110 | None |
| A2FQ57 | 59-171 | None |
| A2FLD5 | 21-138 | None |
| A2F870 | 26-139 | None |
| A2E2U1 | 31-127 | None |
| A2E137 | 4-95 | None |
| A0A1J4JMY3 | 35-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.