DPCstruct | MC10735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 7.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16546 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166J928 | 2-79 | SEEKTQRLVLSVIDFLNVAIKDGTVKEDDREGLEVAVQCIGEAFGVDPSNKEQSDRLSIKPASLPTIFDLFLKTREKF |
| A0A5M8PDA1 | 3-82 | STSDSKKRLALAIIDFLSTSLKDGTLTPEDTDSIEVAQSCIADTFHVDPSDKSAMQAALGGQSLLSIYSVYEKLKGKSTA |
| A0A2I0S8W8 | 1-96 | None |
| A0A367KQZ0 | 2-92 | None |
| R1EFM1 | 864-960 | None |
| A0A4W6FGL6 | 1-99 | None |
| A0A0B6Z8N7 | 1-84 | None |
| A0A1X2G4R4 | 97-195 | None |
| A0A086ST50 | 433-522 | None |
| S8EM35 | 3-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.