DPCstruct | MC10734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 198 ± 26 aa |
| Standard deviation of domain lengths | 25.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L2FRK8 | 2-156 | AELFYQTCPGDWQGDGAFLKECLKAAAWGNTNPDVTVDIGAFVSYRWKLILLADQLIEDLGLPVPGNQTCAMWNEYVWRGEVLYNLE… |
| A0A5M8PBT7 | 233-406 | SGNTVVQAGSIRMSDTLTLPTAAARSALRNMAQKYFNSFPGDSSAATQHRVWVLCVDIVSNKNLPDSDLEFLSAALQFRLVKVVGMA… |
| S3C4J3 | 275-479 | None |
| T0M241 | 21-269 | None |
| A0A1B8ERP4 | 1-231 | None |
| A0A101MNC5 | 14-203 | None |
| Q2H4U4 | 360-543 | None |
| D4DEB9 | 33-224 | None |
| A0A1J7JGJ6 | 528-735 | None |
| J3PDC7 | 343-559 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.