DPCstruct | MC10732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 221 ± 37 aa |
| Standard deviation of domain lengths | 36.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W5D1I6 | 3-204 | MTTSDFKRHNPADPVQDVTNFDFWDVNYRFLTNEISSAGLLFPGNSGLKDNEPLSISNLAAYKSRPNIWLSTDGLVKSFYSTIMTDL… |
| A0A1Q5UD80 | 245-444 | PGIRKGTIYMTPGNSIARDIKSLQFFNIDYRFIVDLGYGNFEVLSPGEDPSVSKLDQGRVYPDVWIIADSLAKSAYSTVLTDLGQIA… |
| A0A428NBU1 | 38-283 | None |
| A0A1L7WY89 | 119-307 | None |
| A0A1V8V4B8 | 23-213 | None |
| A0A4R8RVJ8 | 756-979 | None |
| A0A6A6CD42 | 112-383 | None |
| A0A1J9R212 | 220-458 | None |
| A0A0B7FZM2 | 1-326 | None |
| W9X0I8 | 7-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.