DPCstruct | MC10731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2977 |
|---|---|
| Mean domain length (aa) | 378 ± 94 aa |
| Standard deviation of domain lengths | 93.71 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 78.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.46 |
| Pfam Score | 96.71 |
| Assigned Pfam label(s) | PF03105- CL0318- CL0015- PF07662- CL0032 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W5D1E1 | 201-570 | VAAVSHMGVFQAYLVTHQLAGYSEGAVGWIFGVHVFLAFFSGVQIGPIFDAHGPRWLVAAGSVLLVAGMMLFAVSTRYWHFILTFSI… |
| A0A532TFF6 | 13-386 | KEWCMLISSIFSIFLLMQYHFLFEFVILMERELPYVLIIYHLIGIPIGTIFALKLIYKELNHFTSYLISNAIVIIFFICLIIIDQPW… |
| A0A386UGX9 | 3-231 | None |
| R9NZ16 | 366-886 | None |
| A0A5B7DPQ5 | 2-412 | None |
| A0A7R9PUZ1 | 99-358 | None |
| A0A7R9Q0Z4 | 2-298 | None |
| A0A7R9Q4L7 | 4-395 | None |
| A0A7R9Q669 | 2-348 | None |
| A0A7R9KCV6 | 220-728 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.