DPCstruct | MC10730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 90 ± 12 aa |
| Standard deviation of domain lengths | 11.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 50.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1NYC7 | 4-81 | LGSTKEKRLMIDIMAIRQSYERRELSEIRWINGNDNPADAMTKANATKALKSLIENGELLIQIEGWVQREKEKMPVLE |
| A0A1W5CX74 | 45-132 | VPMVLCIDSKSLYDCLVKLGITQEKRLMVDLMCLRQSYERREITEIIWIKGPTNPADAMTKEKPCPALRRIIDSNKIEVDVDGWVERM |
| A0A834RJA5 | 653-754 | None |
| A0A0B1P6T1 | 149-236 | None |
| E3R0U7 | 120-208 | None |
| B8MPV6 | 468-562 | None |
| A0A7D8YJQ5 | 2-85 | None |
| A0A178EKE6 | 72-159 | None |
| A0A066XGZ7 | 244-331 | None |
| A0A6A5S5B7 | 162-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.