DPCstruct | MC10728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 403 ± 66 aa |
| Standard deviation of domain lengths | 66.30 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W5CTT0 | 35-415 | ATFCNESAMQLPSFSYSISRPYPYRWFTWVVIAGGICATIFLSILNLAANGYILQSKDIPVNSQFFTDKLALPYSLTAVWKRDQGDS… |
| B0E0K1 | 139-557 | ALHPQNILQSNASGLSHYSAFPTEMAMVYSAVLLAFTGYETVTVFESDFNATQSFWYNKYMPYPVPTPGTLCDPHVFNAGDPFTTNY… |
| A0A4S9MB66 | 2-359 | None |
| A0A1J9R212 | 1-439 | None |
| W7MV10 | 3-366 | None |
| A0A1A5ZTL0 | 202-600 | None |
| F8NUE1 | 741-1128 | None |
| A0A074Y394 | 1-287 | None |
| X8JPW1 | 1-516 | None |
| A0A6A6CD42 | 2-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.