DPCstruct | MC10726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 219 ± 23 aa |
| Standard deviation of domain lengths | 23.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF12942- PF02461 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800MQN8 | 2-236 | EAVQVSRTLDYMILFTLFFIILGGYHIHFMLTGGDWDFWSDWKDRRLWVTVCPIVAITFPAAVQAVLWSRYRIAWGATVSILGLLFG… |
| A0A835X8V6 | 6-218 | YIDAILYWIMVWLRRCTHYLFIIVVAVNGTLLTINAGDYIFYTDWAWTSFVIFSISQTLMLTVGAVYYLTFTGVPGTATYYGLIITV… |
| A0A4P6X4K1 | 8-246 | None |
| A0A1H3QFD3 | 46-277 | None |
| B7U9X0 | 8-243 | None |
| A0A7K4FDL4 | 3-186 | None |
| B3T7I1 | 2-213 | None |
| A0A7J9VT24 | 293-524 | None |
| A0A1Y5EST4 | 13-243 | None |
| S2EPZ8 | 4-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.