DPCstruct | MC10722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 69 ± 7 aa |
| Standard deviation of domain lengths | 6.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2JLE7 | 2-52 | IVDVIKQAKKMHNIPCSDCQYFTNDYRLKCPVNPFKATTEAAIDCRDYHIG |
| A0A6B3M557 | 6-76 | SLLALLVGFLYAVIVAWQESVVRLKRLHSIPCNRCVYFTGCHYLKCTVNPYKALTEDAVDCLDFEPTLHSK |
| A0A2T1LZ76 | 1-78 | None |
| A0A2T1D9X5 | 30-105 | None |
| L8M8B9 | 12-68 | None |
| A0A1Z4RQJ6 | 19-88 | None |
| K9RYA3 | 28-96 | None |
| B4VKK2 | 4-63 | None |
| A0A1E5QJ57 | 10-80 | None |
| A0A846DQZ4 | 18-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.