DPCstruct | MC10721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 10.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E4BWW2 | 2-109 | PLFYQDWITREDLRANPDKVYVFGDNVERRGYAGQAKEMRGEPNAIGVVTKWAPSMDSKAYFDDTDACRMLVERDLLVVQQALDRGR… |
| A0A5C5Q925 | 1-116 | MVEAHLSVELLRSNPDKIYVFGDNLLRRGTAGQAAVRGEPNAFGIPTKRAPSMAASAFFSDRPDEVQAVLQALRELYVLARTRTVVF… |
| A0A545SCM6 | 11-132 | None |
| A0A540WI89 | 160-294 | None |
| A0A7X6WN14 | 51-173 | None |
| A0A7Y4N9Q2 | 370-497 | None |
| A0A656GWD7 | 4-121 | None |
| A0A2V5AAH9 | 107-231 | None |
| A0A7C5WQL8 | 576-703 | None |
| A0A7W7KEH4 | 3-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.