DPCstruct | MC10720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 232 ± 11 aa |
| Standard deviation of domain lengths | 11.34 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 72.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0292 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812KPK6 | 1-223 | MKNMLSTFHAYGSVFGLAISASFLLALGILNLCTARQLWMEWKGHGGDHSHHATMGLWLRCCPRLFQAISKPWHMLIVGFLFGLGFD… |
| A0A0E4BU65 | 13-246 | SLLKEIGGLIGTSVSALFLLVIAVINLAIFVGLRRTLREVREQGIHHAARLDALLAHRGLLAHLLGPMFRLVTKPWHMYPLGLLFGL… |
| A0A163LAV8 | 111-351 | None |
| A0A0E9NFW4 | 294-531 | None |
| A0A812YMY4 | 545-788 | None |
| A0A3M7M0E9 | 442-670 | None |
| A0A5M9L326 | 145-372 | None |
| A0A395T0L2 | 260-512 | None |
| A0A0A2VYR0 | 766-993 | None |
| A0A537QVU3 | 111-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.