DPCstruct | MC1072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 194 ± 37 aa |
| Standard deviation of domain lengths | 36.89 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2KZ57 | 5-147 | WIHHFGLFAAVGGAMAALATVLVSPAVLRSARNRMAFLAGLLLVLALCFASTNGWWYVSNFGAPFNNSVPQLGGVTVSTVFFVLFFV… |
| A0A069JF01 | 51-225 | WTHHFGIFAGLTAVLAMMTAVAVGTKLLRSPRNRALFAAAVLFLLAVAFTGSNSYYYVSSYSVPWWDKPVSISGLGASTVLLGLTVL… |
| A0A533IIN9 | 194-394 | None |
| A0A109SBE1 | 1-151 | None |
| X7ZZ56 | 2-190 | None |
| X7ZZ64 | 73-335 | None |
| X7Y9N3 | 2-187 | None |
| A4FJV8 | 111-308 | None |
| X8DI91 | 1-172 | None |
| X7ZJB6 | 86-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.