DPCstruct | MC10715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 55 ± 4 aa |
| Standard deviation of domain lengths | 4.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 80.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822XXL3 | 39-92 | PNIYNALVIKGRDTAGQQINVSCEVQQLLGNNRARAVAMSATDGLMRGMEVIDT |
| A0A0J8BDL5 | 1-55 | MPNIYNALVVTSQDTTGQPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDT |
| A0A822ZWH0 | 40-94 | None |
| A0A830D254 | 1-55 | None |
| A0A445EF65 | 1-55 | None |
| A0A4S8I7R3 | 40-94 | None |
| A0A396GZM9 | 1-47 | None |
| A0A7J7CCK0 | 1-55 | None |
| A0A7J4G2E9 | 20-87 | None |
| A0A6N2MN81 | 1-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.