DPCstruct | MC10714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 147 ± 16 aa |
| Standard deviation of domain lengths | 15.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 64.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.81 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | CL0123- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J8B465 | 1-160 | MGRPPTHGAPSFRFHPAEVAHMEAVLRDHGGHVPAREHLVELAQKFSNSPERAGKITVQMKQVWNWFQNRRYALRSKLVKSPNPRDM… |
| B0LX55 | 1-133 | MTGQAPSLLFRFTDTEVAKMEEVLRDLNAMPKHPVIQGLTDDFNASPDRSGDGKVPVQYNQVRNWFQNRRSAQSRKMMVPPVAEEHH… |
| A0A6P6U2G1 | 1-145 | None |
| D8QZ18 | 1-138 | None |
| A0A6A2YT39 | 1-149 | None |
| A0A2K1IVL7 | 1-130 | None |
| A0A1D6EP19 | 1-126 | None |
| M7Z0Z5 | 132-264 | None |
| A0A7J0G9X2 | 2-135 | None |
| A0A0D3GGT0 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.