DPCstruct | MC10713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 63 ± 0 aa |
| Standard deviation of domain lengths | 0.00 |
| Length coefficient of variation | 0.00 |
| Mean AlphaFold2 pLDDT confidence score | 91.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 71.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02138 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653BZ87 | 396-458 | HHISDVLSPITYYVYMARRTPKSVLCKNVRTVWVPAEYPSSIQRMQEWTPDECIPEFYSDPTV |
| A0A146M2D4 | 389-451 | HHVPDVLSEITYYVYLSRVTPKSILCKYVRPQWVPAEYPASIQRLQSWSPDECIPEFFTDADV |
| A0A2G8LMJ4 | 45-107 | None |
| B4IP02 | 436-498 | None |
| A0A6L5CKS4 | 398-460 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.