DPCstruct | MC10710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 226 ± 37 aa |
| Standard deviation of domain lengths | 37.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.19 |
| Pfam Score | 68.16 |
| Assigned Pfam label(s) | PF19439- PF09758 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812XWF6 | 82-214 | RFVLRHAAESYFSQLAYHLQDLWLRLDAAAAKATGEDNLSQVQRENELQQDLQIYLSDVFELGIEELNEVLADRLLNAAILPVLLAG… |
| A0A2K3N198 | 1-229 | MIRAAVRAVTLNVYHVGDDSVNRYITSAPHTDYFSNLVSFFKKQCMDLNRLISETLKNPGPDSNSTITAAVDEIEDNLYYFSDVISA… |
| A0A131YKR0 | 47-310 | None |
| A0A1I8I5L0 | 188-424 | None |
| A0A6P8I7U2 | 184-493 | None |
| A0A226EV27 | 352-536 | None |
| A9UWT0 | 208-395 | None |
| A0A4S4E2T0 | 176-405 | None |
| A0A3P6DU94 | 389-604 | None |
| A0A2Z6P360 | 1-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.