DPCstruct | MC1071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 289 ± 43 aa |
| Standard deviation of domain lengths | 43.44 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7PVQ3 | 43-358 | TPASGDPLRSRPSVYLDQNHWSTLAQAVTAPDRIRTPEILAAARRLSELASDEGIVLPLSSATLHETYGLFGDRRYEVGLTIGRLSA… |
| A0A069JBS3 | 15-300 | RPTIYLDLWVWIRLAKAAQGVPSHPEDLVAIEALRTASQAGVAFPLSATHYEELHAVADPRQRLDVARTMAEISCMRTLRSPSVMVR… |
| V5E328 | 48-401 | None |
| A0A1G3A837 | 7-296 | None |
| A0A800C5C3 | 90-427 | None |
| A0A3D3URI6 | 1-323 | None |
| A0A2D3U2Z6 | 6-252 | None |
| A0A117S0E8 | 39-374 | None |
| A0A1F2SJ92 | 73-414 | None |
| A0A837E364 | 2-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.