DPCstruct | MC10709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 89 ± 12 aa |
| Standard deviation of domain lengths | 11.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 53.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14288 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K3MV76 | 33-119 | GGFENSERKLNEAASEKVFLKSLENYINWCNYLCIQPVWSSLEAVNEGKKLLYVSLYLLIWGEASNVRFLPECLCYIFHQMAREMDH |
| A0A0K9PAE5 | 172-257 | FFTPVGDDPKLDEDASRNVFEKALDNYFRWCKYLSIHPVCNRMDPVGMRLLFVSLYYLIWGEAANVRFLPECLCYIFHNMAKELTQ |
| A0A1U7VTL4 | 1-107 | None |
| A0A178UEH8 | 269-345 | None |
| A0A287VW53 | 187-265 | None |
| A0A2P2MBJ8 | 306-384 | None |
| A0A453DGY4 | 101-202 | None |
| A0A287Y0V3 | 1-111 | None |
| A0A287PYJ5 | 305-379 | None |
| A0A5D3BGT4 | 263-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.