DPCstruct | MC10708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Standard deviation of domain lengths | 4.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 58.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02365 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6LHD4 | 20-66 | MPGFRFHPTDEELVMYYLKRKICGKKLKFNVICETDVYKWDPEDLPG |
| A0A2K3MKF2 | 2-54 | QGELELPPGFRFHPTDEELVNHYLCRKCAGQSISVPVVKEVDLYKFDPWQLPG |
| A0A0D3CTA8 | 5-58 | None |
| A0A540KMT5 | 1-52 | None |
| F2E2X9 | 4-57 | None |
| A0A4U5R3J0 | 2-54 | None |
| B9G4Y9 | 1-51 | None |
| A0A7G2DYW7 | 12-71 | None |
| A0A7G2EMR5 | 154-211 | None |
| A0A7G2DYU1 | 1-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.