DPCstruct | MC10707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 135 ± 12 aa |
| Standard deviation of domain lengths | 11.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 57.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2DWH1 | 1-132 | MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMDRSSTTQPYLPTAPMVYAVIPDPGIVDNPDLPSYQPHVHGRCDPPALIPLQ… |
| A0A2K3MJB5 | 1-130 | MADEFCRAVDDGMKLSKRIYFGKDRAVAPPKLPTSMERSTNALLPKAPMVYAVISDPAIVDNPDIASYQPHVYGRCDPPALIPLQMN… |
| A0A0A9U9P8 | 1-150 | None |
| A0A6A2XL75 | 661-771 | None |
| A0A426XR44 | 79-206 | None |
| A0A2P5EDH6 | 1-137 | None |
| A0A6A2XV67 | 1-131 | None |
| A0A2G2WGH2 | 4-139 | None |
| A0A453JR14 | 1-157 | None |
| M4EQJ3 | 1-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.